NuGet packages
5,000 in Packages and libraries, most used first. Page 21 of 25.
-
protobuf-net.buildtools Analyzer and Generator support for protobuf-net - tesserae Tesserae is a UI toolkit for building web applications using the Transpose C# to JavaScript compiler
- influxdata.net InfluxData.Net is a fast, portable .NET library to access the REST API of an InfluxDB database and Kapacitor processing tool.
- launchdarkly.commonsdk.jsonnet Integration between LaunchDarkly SDKs and Json.NET (Newtonsoft.Json)
- graphql.common Common GraphQL classes
- opentelemetry.autoinstrumentation.runtime.native Native runtime components used by the OpenTelemetry.AutoInstrumentation project.
- npgsql.fsharp Thin functional F# layer around Npgsql, the PostgreSQL database driver.
- microsoft.netcore.app.crossgen2.linux-musl-x64 Internal implementation package not meant for direct consumption. Please do not reference directly.
- awssdk.securityhub AWS Security Hub provides you with a comprehensive view of your security state within AWS and your compliance with the security industry…
- coreclr-ncalc This is a port of NCalc for .NET Core applications.
- methodboundaryaspect.fody A Fody weaver which allows to decorate methods and hook into method start, method end and method exceptions.
- volo.abp.users.entityframeworkcore Package Description
- smblibrary SMBLibrary is an open-source C# SMB 1.0/CIFS, SMB 2.0, SMB 2.1 and SMB 3.0 server and client implementation
- chutzpah Chutzpah is an open source JavaScript test runner which helps you integrate JavaScript unit testing into your website.
- languageext.rx Support for Reactive Extensions overloads for various types in the LanguageExt functional framework
- azure.resourcemanager.compute Microsoft Azure management client SDK for Azure resource provider Microsoft.Compute.
- xunit.categories Friendly Traits for Xunit
- glimpse.aspnet Glimpse is a web debugging and diagnostics tool used to gain a better understanding of whats happening inside of your ASP.NET 4.0…
- nethereum.contracts Nethereum Contracts is the core library to interact via RPC with Smart contracts in Ethereum
- xamarin.googleplayservices.cloudmessaging .NET for Android and MAUI bindings for the Android Java library 'com.google.android.gms:play-services-cloud-messaging'.
- hangfire.dashboard.authorization Some authorization filters for Hangfire's Dashboard.
- zendeskapi_v2 A full c# wrapper for Zendesk's api v2.
- microsoft.identity.web.graphserviceclient This package enables ASP.NET Core web apps and web APIs to use the Microsoft identity platform (formerly Azure AD v2.0).
- amazon.cdk.aws.autoscaling.common Common implementation package for @aws-cdk/aws-autoscaling and @aws-cdk/aws-applicationautoscaling (Stability: Experimental)
- fstoolkit.errorhandling.taskresult FsToolkit.ErrorHandling is an extensive utility library based around the F# Result type, enabling consistent and powerful error handling.
- steeltoe.extensions.configuration.configserverbase Configuration provider for reading from Spring Cloud Config Server.
- rebex.common Rebex.Common provides platform-independent low-level API to Rebex libraries.
- nethermind.crypto.secp256r1 C# bindings for the BoringSSL ECDSA signature verification
- nethereum.web3 Nethereum.Web3 Ethereum Web3 Class Library to interact via RPC with an Ethereum client, for example geth.
- specflow.assist.dynamic Adds support for dynamic instances and sets from SpecFlow tables
- xdoc.word XDoc.Word is a FREE C# Office Word library to read, convert, edit, create MS-Word documents in .NET projects.
- microsoft.visualstudio.textmanager.interop.8.0 A member of the Visual Studio SDK
- opentelemetry.autoinstrumentation.buildtasks Build tasks used by the OpenTelemetry.AutoInstrumentation project.
- volo.abp.aspnetcore.mvc.ui.bundling.abstractions Package Description
- flurl.http.newtonsoft A Newtonsoft-based JSON serializer for Flurl.Http 4.0 and above.
- easynetq.management.client A .NET client for the RabbitMQ RESTful management API
- dotnetseleniumextras.pageobjects.core Fork of DotNetSeleniumExtras with enabled dotnet core support and other features
- aspose.imaging Aspose.Imaging for .NET is a .NET library that helps your .NET, C#, VB.NET, and ASP.NET applications to process images and photos: convert…
- microsoft.visualstudio.azure.kubernetes.tools.targets Targets files to enable the Visual Studio Tools for Kubernetes.
- skylark.standard Skylark is a collection of tools and resources that can help with developing .NET projects.
- jspool JSPool facilitates easy integration of JavaScript scripting into a .NET application in a scalable and performant manner.
- elmahcore ELMAH for ASP.NET Core
- tunit.assertions A .NET Testing Framework
- hotchocolate.stitching.abstractions Contains the Hot Chocolate GraphQL schema stitching abstractions.
- google.cloud.aiplatform.v1 Recommended Google client library to access the Vertex AI API (v1), which allows you to train high-quality custom machine learning models…
- xact.core.pcl An XActLib Assembly: code common to the whole library using only Portable Class Library references.
- bundletransformer.core Bundle Transformer - a modular extension for the System.Web.Optimization (also known as the Microsoft ASP.NET Web Optimization Framework).
- ilmerge ILMerge is a utility that can be used to merge multiple .NET assemblies into a single assembly.
- opentelemetry.autoinstrumentation.loader Loader used by the OpenTelemetry.AutoInstrumentation project.
- serilog.sinks.spectreconsole A Serilog sink that writes log events to console using Spectre.Console.
- microsoft.sqlpackage SqlPackage is a command-line utility that automates database development tasks by exposing some of the public Data-Tier Application…
- microsoft.testplatform.cli The cross platform Microsoft Test Platform.
- thinkgeo.core ThinkGeo.Core is the cross-platform .NET geospatial engine that powers every ThinkGeo product.
- opentelemetry.autoinstrumentation.startuphook StartupHook used by the OpenTelemetry.AutoInstrumentation project.
- google.cloud.translation.v2 Recommended Google client library to access the Translate v2 API.
- blazorise Blazorise is a component library built on top of Blazor and CSS frameworks like Bootstrap, Bulma and Material.
- nethereum.jsonrpc.rpcclient JsonRpc Rpc Client Nethereum provider
- slugify.core Simple Slug / Clean URL generator helper for Microsoft .NET framework and .NET Standard.
- haukcode.wkhtmltopdfdotnet .NET Core P/Invoke wrapper for wkhtmltopdf library that uses Webkit engine to convert HTML pages to PDF.
- nethereum.accounts Nethereum.Accounts Ethereum Accounts and Transaction Managers Class Library
- chr.avro.binary Avro binary serialization and deserialization
- portable.xaml
- lib.harmony A general non-destructive patch library for .NET and Mono modules.
- xdoc.excel XDoc.Excel is a FREE C# Office Excel library to read, convert, edit, create MS-Excel (.xlsx) documents in .NET projects.
- awssdk.marketplaceentitlementservice AWS Marketplace Entitlement Service enables AWS Marketplace sellers to determine the capacity purchased by their customers.
- htmlrenderer.pdfsharp PDF document generator from HTML snippet, 100% managed (C#), High performance library using PDFsharp.
- aspire.microsoft.entityframeworkcore.sqlserver A Microsoft SQL Server provider for Entity Framework Core that integrates with Aspire, including connection pooling, health check…
- soenneker.extensions.enumerable A collection of helpful enumerable extension methods
- graphql.server.ui.graphiql GraphiQL integration for ASP.NET Core
- volo.abp.permissionmanagement.application Package Description
- azure.resourcemanager.network Microsoft Azure management client SDK for Azure resource provider Microsoft.Network.
- microsoft.maui.graphics.skia .NET Multi-platform App UI (.NET MAUI) is a cross-platform framework for creating native mobile and desktop apps with C# and XAML.
- serilog.sinks.syslogmessages Fully-featured Serilog sink that logs events to remote syslog servers using UDP, TCP, and TLS over TCP, and can also use POSIX libc syslog…
- volo.abp.swashbuckle Package Description
- tunit.engine A .NET Testing Framework
- xamarin.firebase.encoders.proto .NET for Android and MAUI bindings for the Android Java library 'com.google.firebase:firebase-encoders-proto'.
- aiwins.rocket.core Package Description
- nethereumnet NethereumNet contains all Nethereum packages in one for ease of use. Supporting most modern .Net versions
- abp.castle.log4net
- spire.doc Spire.Doc for .NET, specially designed for developers, enables to fast generate, open, write, edit and save Word document from Word…
- opentk.windowing.desktop An abstraction over OpenTK.GraphicsLibraryFramework to provide a ready-to-go easy-to-use windowing and input abstraction.
- microsoft.visualstudio.shell.interop.10.0 A member of the Visual Studio SDK
- reo.core.hosting Package Description
- usync Sync Umbraco to and from disk and between instances
- easycaching.redis A simple distributed caching provider based on StackExchange.Redis.
- opentk.windowing.common Common functionality for OpenTK.Windowing.* packages.
- xam.plugins.settings Settings Plugin .NET 6, .NET MAUI, Xamarin and Windows provides a consistent, cross platform settings/preferences plugin.
- awssdk.guardduty Enable Amazon GuardDuty to continuously monitor and process AWS data sources to identify threats to your AWS accounts and workloads.
- loggly-csharp A .NET client for loggly. Supporting Https, Syslog UDP and encrypted Syslog TCP transports.
- nethermind.gmpbindings C# bindings for the GNU Multiple Precision (GMP) arithmetic library.
- volo.abp.identity.entityframeworkcore Package Description
- oci.dotnetsdk.common The common package provides supporting classes and methods used by service packages.It includes HTTP request/response (de)serialization…
- xdoc.tiff XDoc.TIFF is a FREE C# TIFF library to create, convert, edit multi-page TIFF file in .NET projects.
- selenium.webdriver.msedgedriver Installs the new Edge (Chromium) WebDriver Package to be used with Selenium.
- windowsapicodepack-shellextensions Shell extensions library for Windows API Code Pack
- nethermind.mclbindings C# bindings for the MCL library.
- system.configuration.abstractions Interfaced wrappers around System Configuration ConfigurationManager with support for extensibility points and strongly typed helpers.
- nager.country Get Worldwide country informations and border information
- netbox Provides common simple helper functions to accelerate .NET development.
- json.net A minimalistic JSON handler library.
- hotchocolate.aspnetcore.commandline This package contains the command line extensions for HotChocolate
- entityframework.extended [Deprecated] Use Entity Framework Plus instead: No longer supported since 2015
- jetbrains.profiler.selfapi JetBrains Self-Profiling API lets you initiate and control profiling sessions right from the code of your application.
- uuid.serialization.system Provides System.Text.Json serialization support for the UUID library, enabling seamless JSON serialization and deserialization of UUID…
- umbraco.cms.api.common Contains the bits and pieces that are shared between the Umbraco CMS APIs.
- akka.cluster Clustering support for Akka.NET actors. Used to build highly-available, distributed applications.
- xdoc.powerpoint XDoc.PowerPoint is a FREE C# Office PowerPoint library to read, convert, edit, create PPTX documents in .NET projects.
- loggly-csharp-config Configuration classes for loggly clients. Settings are read from app.config or can be programmatically injected at runtime.
- nuget.build MSBuild targets for nuget package restore and package build.
- syncfusion.blazor.data Syncfusion® Blazor DataManager component for managing data operations in Blazor applications.
- perseuslibs PerseusApi implementation
- windowsapicodepack-sensors Sensors library for Windows API Code Pack
- orleansdashboard A developer dashboard for Microsoft Orleans
- system.io.isolatedstorage Provides classes that allow the creation and use of isolated stores.
- aspnetcore.healthchecks.prometheus.metrics HealthChecks.Publisher.Prometheus is a health check prometheus metrics exporter.
- volo.abp.backgroundjobs.domain Package Description
- exiflib.standard A Fast Exif Data Extractor for .NET Ported ExcifLib 1.7 to .net Standard in April 2018
- xmlrpcnet XML-RPC.NET - an XML-RPC client library for .Net (see xmlrpcnet-server for the server package).
- nuget.build.tasks.pack NuGet tasks for MSBuild and dotnet pack.
- awssdk.inspector Amazon Inspector identifies security issues in your application deployments.
- amazon.cdk.aws.sns The CDK Construct Library for AWS::SNS (Stability: Stable)
- temporalio.extensions.hosting Temporal SDK .NET Hosting and Dependency Injection Extension
- select2.js A jQuery based replacement for select boxes. It supports searching, remote data sets, and infinite scrolling of results.
- octopus.dotnet.cli Octopus Deploy is an automated release management tool for modern developers and DevOps teams.
- windowsapicodepack-extendedlinguisticservices Extended linguistic services for Windows API Code Pack
- opcfoundation.netstandard.opc.ua.configuration OPC UA Configuration Class Library
- aspose.pdf.drawing Aspose.PDF via Drawing for .NET is a PDF document creation and manipulation component that enables your .NET applications to read, write…
- opcfoundation.netstandard.opc.ua.security.certificates OPC UA Security X509 Certificates Class Library
- mailjet.api Official C# client library For Mailjet API version 3. Documentation
- runtime.win10-arm64.microsoft.net.native.sharedlibrary .Net Native Compilers package. Referencing this package will cause the project to be built using the specific version of the .NET Native…
- awssdk.rekognition AWS Rekognition service does image processing and concept recognition, face detection and identification, face verification, similar face…
- serilog.sinks.slack Serilog sink for Slack
- wiseprogress.extensions Wise Progress Extensions
- aforge The AForge library is a core library of AForge.NET framework, which contains core classes used by other libraries of the framework and…
- nuget.protocol.core.types NuGet's protocol-level base types used for connecting to API v2 and API v3 repositories.
- microsoft.azure.management.websites Provides website management capabilities for Microsoft Azure.
- enyimmemcached Memcached client library for .NET based languages.
- microsoft.codeanalysis.metrics Report source based Code Metrics
- wangkanai.detection Introducing Detection – your gateway to understanding your users' interactions with your ASP.NET Core application.
- microsoft.maui.templates.net8 .NET Multi-platform App UI (.NET MAUI) project and item templates.
- reo.core.queue.abstractions Package Description
- opentk.compute OpenCL bindings for dotnet.
- awssdk.storagegateway The AWS Storage Gateway is a service connecting an on-premises software appliance with cloud-based storage to provide seamless and secure…
- opentk.input Hid/Controller input library.
- xunit.extensions.ordering Extensions for ordered testing with Xunit. Full support for ordering at all levels - test collections, test classes and test cases.
- dapperextensions A small library that complements Dapper by adding basic CRUD operations (Get, Insert, Update, Delete) for your POCOs.
- volo.abp.aspnetcore.mvc.ui.multitenancy Package Description
- serilog.sinks.fastconsole Serilog sink that writes to console with high-performance non-blocking output.
- nuget.protocol.core.v3 NuGet Protocol for 3.1.0 servers
- aardvark.base Aardvark is an open-source platform for visual computing, real-time graphics and visualization.
- jering.javascript.nodejs Jering.Javascript.NodeJS enables you to invoke javascript in NodeJS, from C#.
- google.apis.container.v1 This is not the recommended package for working with Container, please use the Google.Cloud.Container.V1 package.
- sodium.core libsodium for .net core
- expressionevaluator We moved here: NOTE: The current package is UNSUPPORTED since 2016
- cachemanager.stackexchange.redis CacheManager extension package which adds support for Redis as a distributed cache layer.
- eventstore.client.grpc The base GRPC client library for Event Store.
- dapper.simplecrud Simple Get, GetList, GetListPaged, Insert, Update, Delete, DeleteList, and RecordCount extensions for Dapper.
- amazon.cdk.aws.applicationautoscaling The CDK Construct Library for AWS::ApplicationAutoScaling (Stability: Stable)
- microsoft.netframework.referenceassemblies.net40 Microsoft .NET Framework Reference Assemblies
- dapr.extensions.configuration Dapr Secret Store configuration provider implementation for Microsoft.Extensions.Configuration.
- docnet.core DocNET is a fast PDF editing and reading library for modern .NET applications.
- opentk.redist.glfw GLFW redistributables for OpenTK.
- sourcegear.sqlite3 This package contains builds of the native SQLite code for various platforms. These builds have "e_sqlite3" as the base name.
- dateonlytimeonly.aspnet Adds support for receiving and returning DateOnly/TimeOnly as ISO 8601 string to ASP.NET Core API
- awssdk.accessanalyzer Introducing AWS IAM Access Analyzer, an IAM feature that makes it easy for AWS customers to ensure that their resource-based policies…
- efcoresecondlevelcacheinterceptor Entity Framework Core Second Level Caching Library.
- jquery.datatables DataTables is a plug-in for the jQuery Javascript library. It is a highly flexible tool, based upon the foundations of progressive…
- delegatedecompiler.entityframework A library which is able to decompile a delegate or a method body to its lambda representation
- win2d.uwp An easy-to-use Windows Runtime API for immediate mode 2D graphics rendering. For the Universal Windows Platform (Windows 10).
- google.apis.peopleservice.v1 Google APIs Client Library for working with People…
- wixtoolset.dtf.windowsinstaller Managed libraries for Windows Installer
- unity.microsoft.dependencyinjection Unity for Microsoft Dependency Injection framework.
- soenneker.utils.regexcollection A collection of regular expressions that are generated at compile time
- syncfusion.doctopdfconverter.wpf This package provides the functionality to utilize the features of Syncfusion® WPF Word-To-PDF control and more.
- stackifylib Package Description
- microsoft.windowsappsdk.base The Windows App SDK empowers all Windows Desktop apps with modern Windows UI, APIs, and platform features, including back-compat support.
- prometheus-net.contrib Package Description
- nuget.commands Complete commands common to command-line and GUI NuGet clients.
- microsoft.aspnet.scriptmanager.webforms This package contains the Microsoft.ScriptManager.WebForms assembly that will automatically register the Microsoft Ajax optimization…
- rebus.microsoft.extensions.logging Microsoft.Extensions.Logging-based logging integration for Rebus
- tomlyn Tomlyn is a high-performance .NET TOML 1.1 parser, round-trippable syntax tree, and System.Text.Json-style object serializer - NativeAOT…
- altv.net.async AltV .NET Core Async Server Api
- google.apis.compute.beta Google APIs Client Library for working with Compute beta.
- syncfusion.blazor.popups Syncfusion® Provides Blazor popup and overlay components for building interactive dialogs and tooltips.
- valapi.net A class library for interacting with the Valorant In Game API.
- microsoft.web.services3 WSE 3.0 simplifies the development and deployment of secure Web services.
- configureawaitchecker.analyzer Checks for ConfigureAwait(false) usage. More info: *…
- humanizer.core.lt Humanizer Locale Lithuanian (lt)
- humanizer.core.lb Humanizer Locale Luxembourgish (lb)
- nethereum.blockchainprocessing Nethereum.BlockchainProcessing Ethereum blockchain processing allowing to crawl Blocks, Transactions, TransactionReceipts and Logs (Event)…
- autofac.diagnostics.dotgraph Autofac diagnostics support to enable DOT graph visualization of resolve requests.
- sqlitepclraw.bundle_e_sqlcipher This 'batteries-included' bundle brings in SQLitePCLRaw.core and the necessary stuff for certain common use cases.
- entityframework.codefirststorefunctions Support for store functions (table valued functions, scalar user defined functions and stored procedures) for Entity Framework 6.3.0+ Code…
- dotnetcore.cap.rabbitmq Distributed transaction solution in micro-service base on eventually consistency, also an eventbus with Outbox pattern.
- masstransit.testframework MassTransit Test Framework (NUnit); MassTransit provides a developer-focused, modern platform for creating distributed applications…
- pathoschild.http.fluentclient A modern async HTTP client for REST APIs. Its fluent interface lets you send an HTTP request and parse the response in one go.
- iconic.zlib.netstandard A .NETStandard port of Iconic.Zlib from DotNetZip project.
- syncfusion.blazor.splitbuttons Syncfusion® Provides Blazor button components for building advanced button interfaces.
- ninject.extensions.namedscope Extension for Ninject which allows bindings to define additional scope types.
- zkweb.system.drawing This is a .Net Core compatible System.Drawing implementation modified from mono project, works on windows and linux.
Nothing on this page matches. Search all 85,062 technologies.